THYN1 anticorps (Middle Region)
-
- Antigène Voir toutes THYN1 Anticorps
- THYN1 (Thymocyte Nuclear Protein 1 (THYN1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp THYN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- THYN1 antibody was raised against the middle region of THYN1
- Purification
- Affinity purified
- Immunogène
- THYN1 antibody was raised using the middle region of THYN1 corresponding to a region with amino acids NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK
- Top Product
- Discover our top product THYN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
THYN1 Blocking Peptide, catalog no. 33R-6820, is also available for use as a blocking control in assays to test for specificity of this THYN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THYN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- THYN1 (Thymocyte Nuclear Protein 1 (THYN1))
- Autre désignation
- THYN1 (THYN1 Produits)
- Synonymes
- anticorps my105, anticorps thy28, anticorps mds012, anticorps hspc144, anticorps thy28kd, anticorps zgc:66269, anticorps MDS012, anticorps MY105, anticorps THY28, anticorps THY28KD, anticorps D730042P09Rik, anticorps HSPC144, anticorps Thy28, anticorps thymocyte nuclear protein 1, anticorps Thymocyte nuclear protein 1, anticorps thyn1, anticorps THYN1, anticorps PTRG_09699, anticorps MCYG_02665, anticorps EIO_2684, anticorps thYN1, anticorps Thyn1
- Sujet
- THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.
- Poids moléculaire
- 26 kDa (MW of target protein)
-