C11orf53 anticorps (Middle Region)

N° du produit ABIN632297

L’anticorps Lapin Polyclonal anti-C11orf53 a été validé pour WB. Il convient pour détecter C11orf53 dans des échantillons de Humain et Rat.

Aperçu rapide pour C11orf53 anticorps (Middle Region) (ABIN632297)

Antigène: C11orf53 (Chromosome 11 Open Reading Frame 53 (C11orf53))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C11orf53 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C11orf53 anticorps

Épitope: Middle Region

Specificité: C11 ORF53 antibody was raised against the middle region of C11 rf53

Purification: Affinity purified

Immunogène: C11 ORF53 antibody was raised using the middle region of C11 rf53 corresponding to a region with amino acids SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C11ORF53 Blocking Peptide, (ABIN5612390), is also available for use as a blocking control in assays to test for specificity of this C11ORF53 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF53 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C11orf53

Antigène: C11orf53 (Chromosome 11 Open Reading Frame 53 (C11orf53))

Autre désignation: C11ORF53

Sujet: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 25 kDa (MW of target protein)