XAF1 anticorps (Middle Region)

N° du produit ABIN632298

Cet anticorps anti-XAF1 Polyclonal Lapin (ABIN632298) détecte spécifiquement XAF1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour XAF1 anticorps (Middle Region) (ABIN632298)

Antigène: XAF1 (XiAP Associated Factor 1 (XAF1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XAF1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-XAF1 anticorps

Épitope: Middle Region

Specificité: XAF1 antibody was raised against the middle region of XAF1

Purification: Affinity purified

Immunogène: XAF1 antibody was raised using the middle region of XAF1 corresponding to a region with amino acids SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XAF1 Blocking Peptide, (ABIN5617035), is also available for use as a blocking control in assays to test for specificity of this XAF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XAF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XAF1

Antigène: XAF1 (XiAP Associated Factor 1 (XAF1))

Autre désignation: XAF1

Sujet: X-linked inhibitor of apoptosis is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases.

Poids moléculaire: 34 kDa (MW of target protein)