Esterase D anticorps (N-Term)

N° du produit ABIN632304

Cet anticorps anti-Esterase D est un anticorps Lapin Polyclonal détectant Esterase D dans WB. Adapté pour Humain.

Aperçu rapide pour Esterase D anticorps (N-Term) (ABIN632304)

Antigène: Esterase D (ESD)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Esterase D est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Esterase D anticorps

Épitope: N-Term

Specificité: ESD antibody was raised against the N terminal of ESD

Purification: Affinity purified

Immunogène: ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ESD Blocking Peptide, (ABIN5613402), is also available for use as a blocking control in assays to test for specificity of this ESD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Esterase D

Antigène: Esterase D (ESD)

Autre désignation: ESD

Sujet: ESD is a serine hydrolase involved in the detoxification of formaldehyde.

Poids moléculaire: 31 kDa (MW of target protein)