Esterase D anticorps (N-Term)
-
- Antigène Voir toutes Esterase D (ESD) Anticorps
- Esterase D (ESD)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Esterase D est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ESD antibody was raised against the N terminal of ESD
- Purification
- Affinity purified
- Immunogène
- ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW
- Top Product
- Discover our top product ESD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ESD Blocking Peptide, catalog no. 33R-5690, is also available for use as a blocking control in assays to test for specificity of this ESD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Esterase D (ESD)
- Autre désignation
- ESD (ESD Produits)
- Synonymes
- anticorps FGH, anticorps Es-10, anticorps Es10, anticorps sid478, anticorps wu:fb58f05, anticorps zgc:111984, anticorps ARABIDOPSIS THALIANA S-FORMYLGLUTATHIONE HYDROLASE, anticorps ATSFGH, anticorps S-formylglutathione hydrolase, anticorps T32G6.5, anticorps T32G6_5, anticorps esterase D, anticorps esterase D/formylglutathione hydrolase, anticorps S-formylglutathione hydrolase, anticorps esterase D L homeolog, anticorps ESD, anticorps Esd, anticorps esd, anticorps SFGH, anticorps esd.L, anticorps NMA1519, anticorps LOC100282053
- Sujet
- ESD is a serine hydrolase involved in the detoxification of formaldehyde.
- Poids moléculaire
- 31 kDa (MW of target protein)
-