SUN3 anticorps (C-Term)

N° du produit ABIN632305

Détail du produit anti-SUN3 anticorps

Antigène: SUN3 (Sad1 and UNC84 Domain Containing 3 (SUN3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUN3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SUNC1 antibody was raised against the C terminal of SUNC1

Purification: Affinity purified

Immunogène: SUNC1 antibody was raised using the C terminal of SUNC1 corresponding to a region with amino acids IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SUNC1 Blocking Peptide, catalog no. 33R-4024, is also available for use as a blocking control in assays to test for specificity of this SUNC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUNC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SUN3

Antigène: SUN3 (Sad1 and UNC84 Domain Containing 3 (SUN3))

Autre désignation: SUNC1 (SUN3 Produits)

Synonymes: anticorps SUNC1, anticorps D630047F21Rik, anticorps Sunc1, anticorps Sad1 and UNC84 domain containing 3, anticorps SUN3, anticorps Sun3

Sujet: SUNC1 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.

Poids moléculaire: 40 kDa (MW of target protein)