Syntrophin gamma 1 anticorps (Middle Region)

N° du produit ABIN632306

L’anticorps Lapin Polyclonal anti-Syntrophin gamma 1 a été validé pour WB. Il convient pour détecter Syntrophin gamma 1 dans des échantillons de Humain.

Aperçu rapide pour Syntrophin gamma 1 anticorps (Middle Region) (ABIN632306)

Antigène: Syntrophin gamma 1 (SNTG1) (Syntrophin, gamma 1 (SNTG1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Syntrophin gamma 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Syntrophin gamma 1 anticorps

Épitope: Middle Region

Specificité: Syntrophin Gamma 1 antibody was raised against the middle region of SNTG1

Purification: Affinity purified

Immunogène: Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Syntrophin Gamma 1 Blocking Peptide, (ABIN5616483), is also available for use as a blocking control in assays to test for specificity of this Syntrophin Gamma 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNTG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Syntrophin gamma 1

Antigène: Syntrophin gamma 1 (SNTG1) (Syntrophin, gamma 1 (SNTG1))

Autre désignation: Syntrophin gamma 1

Sujet: The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins.

Poids moléculaire: 58 kDa (MW of target protein)