Syntrophin gamma 1 anticorps (Middle Region)
-
- Antigène Voir toutes Syntrophin gamma 1 (SNTG1) Anticorps
- Syntrophin gamma 1 (SNTG1) (Syntrophin, gamma 1 (SNTG1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Syntrophin gamma 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Syntrophin Gamma 1 antibody was raised against the middle region of SNTG1
- Purification
- Affinity purified
- Immunogène
- Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS
- Top Product
- Discover our top product SNTG1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Syntrophin Gamma 1 Blocking Peptide, catalog no. 33R-7908, is also available for use as a blocking control in assays to test for specificity of this Syntrophin Gamma 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNTG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Syntrophin gamma 1 (SNTG1) (Syntrophin, gamma 1 (SNTG1))
- Autre désignation
- Syntrophin gamma 1 (SNTG1 Produits)
- Sujet
- The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins.
- Poids moléculaire
- 58 kDa (MW of target protein)
-