LCA5 anticorps (N-Term)

N° du produit ABIN632308

Cet anticorps Lapin Polyclonal détecte spécifiquement LCA5 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour LCA5 anticorps (N-Term) (ABIN632308)

Antigène: LCA5 (Leber Congenital Amaurosis 5 (LCA5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCA5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LCA5 anticorps

Épitope: N-Term

Specificité: LCA5 antibody was raised against the N terminal of LCA5

Purification: Affinity purified

Immunogène: LCA5 antibody was raised using the N terminal of LCA5 corresponding to a region with amino acids FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LCA5 Blocking Peptide, (ABIN938457), is also available for use as a blocking control in assays to test for specificity of this LCA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LCA5

Antigène: LCA5 (Leber Congenital Amaurosis 5 (LCA5))

Autre désignation: LCA5

Sujet: LCA5 is a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Mutations in this gene cause Leber congenital amaurosis type V. Alternative splicing results in two transcript variants.

Poids moléculaire: 80 kDa (MW of target protein)