KLHDC2 anticorps (N-Term)

N° du produit ABIN632311

Détail du produit anti-KLHDC2 anticorps

Antigène: KLHDC2 (Kelch Domain Containing 2 (KLHDC2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHDC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: KLHDC2 antibody was raised against the N terminal of KLHDC2

Purification: Affinity purified

Immunogène: KLHDC2 antibody was raised using the N terminal of KLHDC2 corresponding to a region with amino acids VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHDC2 Blocking Peptide, catalog no. 33R-9800, is also available for use as a blocking control in assays to test for specificity of this KLHDC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHDC2

Antigène: KLHDC2 (Kelch Domain Containing 2 (KLHDC2))

Autre désignation: KLHDC2 (KLHDC2 Produits)

Synonymes: anticorps MGC82652, anticorps HCLP-1, anticorps HCLP1, anticorps LCP, anticorps 2310022K15Rik, anticorps D12Ertd522e, anticorps kelch domain containing 2 L homeolog, anticorps kelch domain containing 2, anticorps klhdc2.L, anticorps KLHDC2, anticorps Klhdc2

Sujet: KLHDC2 represses CREB3-mediated transcription by interfering with CREB3-DNA binding. It contains 6 Kelch repeats.

Poids moléculaire: 46 kDa (MW of target protein)