TC2N anticorps (Middle Region)

N° du produit ABIN632322

Cet anticorps anti-TC2N Polyclonal Lapin (ABIN632322) détecte spécifiquement TC2N dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour TC2N anticorps (Middle Region) (ABIN632322)

Antigène: TC2N (Tandem C2 Domains, Nuclear (TC2N))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TC2N est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TC2N anticorps

Épitope: Middle Region

Specificité: TC2 N antibody was raised against the middle region of TC2

Purification: Affinity purified

Immunogène: TC2 N antibody was raised using the middle region of TC2 corresponding to a region with amino acids SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TC2N Blocking Peptide, (ABIN5616526), is also available for use as a blocking control in assays to test for specificity of this TC2N antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TC2N

Antigène: TC2N (Tandem C2 Domains, Nuclear (TC2N))

Autre désignation: TC2N

Sujet: The specific function of TC2N is not yet known.

Poids moléculaire: 55 kDa (MW of target protein)