PDXK anticorps

N° du produit ABIN632330

L’anticorps anti-PDXK Polyclonal Lapin est utilisé pour la détection de PDXK dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour PDXK anticorps (ABIN632330)

Antigène: PDXK (Pyridoxal Kinase (PDXK))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDXK est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDXK anticorps

Purification: Affinity purified

Immunogène: PDXK antibody was raised using a synthetic peptide corresponding to a region with amino acids RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDXK Blocking Peptide, (ABIN5615299), is also available for use as a blocking control in assays to test for specificity of this PDXK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDXK

Antigène: PDXK (Pyridoxal Kinase (PDXK))

Autre désignation: PDXK

Sujet: PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer.

Poids moléculaire: 34 kDa (MW of target protein)