SYDE1 anticorps

N° du produit ABIN632336

Détail du produit anti-SYDE1 anticorps

Antigène: SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SYDE1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SYDE1 Blocking Peptide, catalog no. 33R-7447, is also available for use as a blocking control in assays to test for specificity of this SYDE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYDE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SYDE1

Antigène: SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))

Autre désignation: SYDE1 (SYDE1 Produits)

Synonymes: anticorps 7h3, anticorps 1200008N06Rik, anticorps BB043000, anticorps RGD1305857, anticorps synapse defective Rho GTPase homolog 1, anticorps synapse defective 1, Rho GTPase, homolog 1 (C. elegans), anticorps SYDE1, anticorps Syde1

Sujet: SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Poids moléculaire: 80 kDa (MW of target protein)