EXOC6 anticorps (N-Term)

N° du produit ABIN632342

L’anticorps Lapin Polyclonal anti-EXOC6 a été validé pour WB. Il convient pour détecter EXOC6 dans des échantillons de Humain.

Aperçu rapide pour EXOC6 anticorps (N-Term) (ABIN632342)

Antigène: EXOC6 (Exocyst Complex Component 6 (EXOC6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXOC6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EXOC6 anticorps

Épitope: N-Term

Specificité: EXOC6 antibody was raised against the N terminal of EXOC6

Purification: Affinity purified

Immunogène: EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOC6 Blocking Peptide, (ABIN5613429), is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXOC6

Antigène: EXOC6 (Exocyst Complex Component 6 (EXOC6))

Autre désignation: EXOC6

Sujet: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Poids moléculaire: 88 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis