BCL7A anticorps (Middle Region)

N° du produit ABIN632344

Cet anticorps Lapin Polyclonal détecte spécifiquement BCL7A dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour BCL7A anticorps (Middle Region) (ABIN632344)

Antigène: BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BCL7A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BCL7A anticorps

Épitope: Middle Region

Specificité: BCL7 A antibody was raised against the middle region of BCL7

Purification: Affinity purified

Immunogène: BCL7 A antibody was raised using the middle region of BCL7 corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BCL7A Blocking Peptide, (ABIN937090), is also available for use as a blocking control in assays to test for specificity of this BCL7A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BCL7A

Antigène: BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))

Autre désignation: BCL7A

Sujet: This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 25 kDa (MW of target protein)