BCL7A anticorps (Middle Region)
-
- Antigène Voir toutes BCL7A Anticorps
- BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BCL7A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BCL7 A antibody was raised against the middle region of BCL7
- Purification
- Affinity purified
- Immunogène
- BCL7 A antibody was raised using the middle region of BCL7 corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
- Top Product
- Discover our top product BCL7A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BCL7A Blocking Peptide, catalog no. 33R-1704, is also available for use as a blocking control in assays to test for specificity of this BCL7A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))
- Autre désignation
- BCL7A (BCL7A Produits)
- Synonymes
- anticorps BCL7, anticorps cb585, anticorps id:ibd1097, anticorps sb:cb585, anticorps wu:fk02d01, anticorps zgc:92023, anticorps 4432415N06Rik, anticorps AI448316, anticorps bcl7a, anticorps MGC89576, anticorps BCL7A, anticorps BCL tumor suppressor 7A, anticorps B-cell CLL/lymphoma 7A, anticorps B cell CLL/lymphoma 7A, anticorps B-cell CLL/lymphoma 7A L homeolog, anticorps BCL7A, anticorps bcl7a, anticorps Bcl7a, anticorps bcl7a.L
- Sujet
- This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 25 kDa (MW of target protein)
-