NDRG2 anticorps (C-Term)

N° du produit ABIN632346

Cet anticorps anti-NDRG2 est un anticorps Lapin Polyclonal détectant NDRG2 dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour NDRG2 anticorps (C-Term) (ABIN632346)

Antigène: NDRG2 (NDRG Family Member 2 (NDRG2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDRG2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NDRG2 anticorps

Épitope: C-Term

Specificité: NDRG2 antibody was raised against the C terminal of NDRG2

Purification: Affinity purified

Immunogène: NDRG2 antibody was raised using the C terminal of NDRG2 corresponding to a region with amino acids GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDRG2 Blocking Peptide, (ABIN939066), is also available for use as a blocking control in assays to test for specificity of this NDRG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDRG2

Antigène: NDRG2 (NDRG Family Member 2 (NDRG2))

Autre désignation: NDRG2

Sujet: The NDRG2 gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.

Poids moléculaire: 39 kDa (MW of target protein)