NDRG2 anticorps (C-Term)
-
- Antigène Voir toutes NDRG2 Anticorps
- NDRG2 (NDRG Family Member 2 (NDRG2))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NDRG2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NDRG2 antibody was raised against the C terminal of NDRG2
- Purification
- Affinity purified
- Immunogène
- NDRG2 antibody was raised using the C terminal of NDRG2 corresponding to a region with amino acids GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG
- Top Product
- Discover our top product NDRG2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NDRG2 Blocking Peptide, catalog no. 33R-3680, is also available for use as a blocking control in assays to test for specificity of this NDRG2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NDRG2 (NDRG Family Member 2 (NDRG2))
- Autre désignation
- NDRG2 (NDRG2 Produits)
- Synonymes
- anticorps NDRG2, anticorps AI182517, anticorps AU040374, anticorps Ndr2, anticorps SYLD, anticorps im:6909381, anticorps si:dkey-88n24.1, anticorps zgc:101847, anticorps NDRG family member 2, anticorps N-myc downstream regulated gene 2, anticorps NDRG family member 2 S homeolog, anticorps ndrg2, anticorps NDRG2, anticorps Ndrg2, anticorps ndrg2.S
- Sujet
- The NDRG2 gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.
- Poids moléculaire
- 39 kDa (MW of target protein)
-