MTHFS anticorps

N° du produit ABIN632349

Cet anticorps anti-MTHFS Polyclonal Lapin (ABIN632349) détecte spécifiquement MTHFS dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour MTHFS anticorps (ABIN632349)

Antigène: MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTHFS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MTHFS anticorps

Purification: Affinity purified

Immunogène: MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTHFS Blocking Peptide, (ABIN5614869), is also available for use as a blocking control in assays to test for specificity of this MTHFS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTHFS

Antigène: MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))

Autre désignation: MTHFS

Sujet: MTHFS contributes to tetrahydrofolate metabolism. It helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.

Poids moléculaire: 23 kDa (MW of target protein)