RWDD2A anticorps (N-Term)

N° du produit ABIN632350

Cet anticorps Lapin Polyclonal détecte spécifiquement RWDD2A dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour RWDD2A anticorps (N-Term) (ABIN632350)

Antigène: RWDD2A (RWD Domain Containing 2A (RWDD2A))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RWDD2A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RWDD2A anticorps

Épitope: N-Term

Specificité: RWDD2 A antibody was raised against the N terminal of RWDD2

Purification: Affinity purified

Immunogène: RWDD2 A antibody was raised using the N terminal of RWDD2 corresponding to a region with amino acids NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RWDD2A Blocking Peptide, (ABIN5615979), is also available for use as a blocking control in assays to test for specificity of this RWDD2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RWDD2A

Antigène: RWDD2A (RWD Domain Containing 2A (RWDD2A))

Autre désignation: RWDD2A

Sujet: The specific function of RWDD2A is not yet known.

Poids moléculaire: 32 kDa (MW of target protein)