RWDD2A anticorps (N-Term)

N° du produit ABIN632350

Détail du produit anti-RWDD2A anticorps

Antigène: RWDD2A (RWD Domain Containing 2A (RWDD2A))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RWDD2A est non-conjugé

Application: Western Blotting (WB)

Specificité: RWDD2 A antibody was raised against the N terminal of RWDD2

Purification: Affinity purified

Immunogène: RWDD2 A antibody was raised using the N terminal of RWDD2 corresponding to a region with amino acids NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RWDD2A Blocking Peptide, catalog no. 33R-6639, is also available for use as a blocking control in assays to test for specificity of this RWDD2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RWDD2A

Antigène: RWDD2A (RWD Domain Containing 2A (RWDD2A))

Autre désignation: RWDD2A (RWDD2A Produits)

Synonymes: anticorps RWDD2, anticorps dJ747H23.2, anticorps 1700030C20Rik, anticorps AI848608, anticorps Rwdd2, anticorps RWD domain containing 2A, anticorps RWDD2A, anticorps Rwdd2a

Sujet: The specific function of RWDD2A is not yet known.

Poids moléculaire: 32 kDa (MW of target protein)