FBXL14 anticorps (N-Term)

N° du produit ABIN632352

Cet anticorps anti-FBXL14 est un anticorps Lapin Polyclonal détectant FBXL14 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour FBXL14 anticorps (N-Term) (ABIN632352)

Antigène: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXL14 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FBXL14 anticorps

Épitope: N-Term

Specificité: FBXL14 antibody was raised against the N terminal of FBXL14

Purification: Affinity purified

Immunogène: FBXL14 antibody was raised using the N terminal of FBXL14 corresponding to a region with amino acids WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXL14 Blocking Peptide, (ABIN5613528), is also available for use as a blocking control in assays to test for specificity of this FBXL14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXL14

Antigène: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Autre désignation: FBXL14

Sujet: FBXL14 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

Poids moléculaire: 46 kDa (MW of target protein)