FBXL14 anticorps (N-Term)

N° du produit ABIN632352

Détail du produit anti-FBXL14 anticorps

Antigène: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXL14 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXL14 antibody was raised against the N terminal of FBXL14

Purification: Affinity purified

Immunogène: FBXL14 antibody was raised using the N terminal of FBXL14 corresponding to a region with amino acids WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXL14 Blocking Peptide, catalog no. 33R-9997, is also available for use as a blocking control in assays to test for specificity of this FBXL14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXL14

Antigène: FBXL14 (F-Box and Leucine-Rich Repeat Protein 14 (FBXL14))

Autre désignation: FBXL14 (FBXL14 Produits)

Synonymes: anticorps AW322056, anticorps Fbx14l, anticorps Fbl14, anticorps Ppa, anticorps fbl13, anticorps fbxl14, anticorps ppab, anticorps wu:fc44g06, anticorps CG9952, anticorps Dmel\CG9952, anticorps FBXL14, anticorps I-55, anticorps T21F11.10, anticorps T21F11_10, anticorps PPA, anticorps fi25d04, anticorps ppaa, anticorps wu:fb34d05, anticorps wu:fi25d04, anticorps F-box and leucine-rich repeat protein 14, anticorps F-box and leucine rich repeat protein 14, anticorps F-box and leucine-rich repeat protein 14 S homeolog, anticorps F-box and leucine-rich repeat protein 14b, anticorps Partner of paired, anticorps RNI-like superfamily protein, anticorps F-box and leucine-rich repeat protein 14a, anticorps Fbxl14, anticorps FBXL14, anticorps fbxl14.S, anticorps fbxl14b, anticorps Ppa, anticorps AT1G80570, anticorps fbxl14a

Sujet: FBXL14 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

Poids moléculaire: 46 kDa (MW of target protein)