FBXO16 anticorps (N-Term)
-
- Antigène Voir toutes FBXO16 Anticorps
- FBXO16 (F-Box Protein 16 (FBXO16))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXO16 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXO16 antibody was raised against the N terminal of FBXO16
- Purification
- Affinity purified
- Immunogène
- FBXO16 antibody was raised using the N terminal of FBXO16 corresponding to a region with amino acids CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA
- Top Product
- Discover our top product FBXO16 Anticorps primaire
-
anti-F-Box Protein 16 (FBXO16) antibody
FBXO16 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 16 (FBXO16) (AA 245-272), (C-Term) antibodyFBXO16 Reactivité: Humain WB Hôte: Lapin Polyclonal RB37865 unconjugated
anti-F-Box Protein 16 (FBXO16) (AA 1-100) antibodyFBXO16 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-F-Box Protein 16 (FBXO16) (AA 194-243) antibodyFBXO16 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Lapin, Cobaye, Porc, Poisson zèbre (Danio rerio), Roussette (Chauve-souris), Singe WB Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 16 (FBXO16) (AA 74-123) antibodyFBXO16 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Lapin, Porc, Roussette (Chauve-souris), Singe WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXO16 Blocking Peptide, catalog no. 33R-1795, is also available for use as a blocking control in assays to test for specificity of this FBXO16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXO16 (F-Box Protein 16 (FBXO16))
- Autre désignation
- FBXO16 (FBXO16 Produits)
- Sujet
- FBXO16 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO16 belongs to the Fbx class.
- Poids moléculaire
- 34 kDa (MW of target protein)
-
