FBXO36 anticorps (N-Term)

N° du produit ABIN632357

L’anticorps Lapin Polyclonal anti-FBXO36 a été validé pour WB. Il convient pour détecter FBXO36 dans des échantillons de Humain.

Aperçu rapide pour FBXO36 anticorps (N-Term) (ABIN632357)

Antigène: FBXO36 (F-Box Protein 36 (FBXO36))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO36 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FBXO36 anticorps

Épitope: N-Term

Specificité: FBXO36 antibody was raised against the N terminal of FBXO36

Purification: Affinity purified

Immunogène: FBXO36 antibody was raised using the N terminal of FBXO36 corresponding to a region with amino acids QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO36 Blocking Peptide, (ABIN5613547), is also available for use as a blocking control in assays to test for specificity of this FBXO36 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO36

Antigène: FBXO36 (F-Box Protein 36 (FBXO36))

Autre désignation: FBXO36

Sujet: Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Poids moléculaire: 22 kDa (MW of target protein)