UFL1 anticorps (Middle Region)

N° du produit ABIN632366

L’anticorps anti-UFL1 Polyclonal Lapin est utilisé pour la détection de UFL1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour UFL1 anticorps (Middle Region) (ABIN632366)

Antigène: UFL1 (UFM1-Specific Ligase 1 (UFL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UFL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UFL1 anticorps

Épitope: Middle Region

Specificité: KIAA0776 antibody was raised against the middle region of KIAA0776

Purification: Affinity purified

Immunogène: KIAA0776 antibody was raised using the middle region of KIAA0776 corresponding to a region with amino acids EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA0776 Blocking Peptide, (ABIN938210), is also available for use as a blocking control in assays to test for specificity of this KIAA0776 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0776 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UFL1

Antigène: UFL1 (UFM1-Specific Ligase 1 (UFL1))

Autre désignation: KIAA0776

Sujet: KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.

Poids moléculaire: 89 kDa (MW of target protein)