Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) anticorps

N° du produit ABIN632367

Cet anticorps anti- est un anticorps Lapin Polyclonal détectant dans WB. Adapté pour Humain.

Aperçu rapide pour Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) anticorps (ABIN632367)

Antigène: Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: LRRC51 antibody was raised against the N terminal of LRRC51

Purification: Affinity purified

Immunogène: LRRC51 antibody was raised using the N terminal of LRRC51 corresponding to a region with amino acids MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC51 Blocking Peptide, (ABIN5614579), is also available for use as a blocking control in assays to test for specificity of this LRRC51 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC51 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)

Autre désignation: LRRC51

Sujet: LRRC51 encodes two different proteins. One is a leucine-rich transmembrane protein of unknown function while the other is an O-methyltransferase. Defects in the O-methyltransferase protein can cause nonsyndromic deafness. Several transcript variants encoding different isoforms of each protein have been found for this gene, along with a transcript that is not thought to be protein-coding.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Sensory Perception of Sound