Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) (N-Term) anticorps
-
- Antigène Voir toutes Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT) Anticorps
- Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- LRRC51 antibody was raised against the N terminal of LRRC51
- Purification
- Affinity purified
- Immunogène
- LRRC51 antibody was raised using the N terminal of LRRC51 corresponding to a region with amino acids MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL
- Top Product
- Discover our top product LRTOMT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRRC51 Blocking Peptide, catalog no. 33R-6248, is also available for use as a blocking control in assays to test for specificity of this LRRC51 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC51 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Leucine Rich Transmembrane and 0-Methyltransferase Domain Containing (LRTOMT)
- Autre désignation
- LRRC51 (LRTOMT Produits)
- Synonymes
- anticorps DFNB63, anticorps LRRC51, anticorps Lrtomt, anticorps RGD1561509, anticorps lrrp51, anticorps lrtomt, anticorps zgc:153736, anticorps leucine rich transmembrane and O-methyltransferase domain containing, anticorps leucine-rich repeat-containing protein 51, anticorps leucine rich repeat containing 51, anticorps LRTOMT, anticorps LRRC51, anticorps Lrtomt, anticorps lrrc51
- Sujet
- LRRC51 encodes two different proteins. One is a leucine-rich transmembrane protein of unknown function while the other is an O-methyltransferase. Defects in the O-methyltransferase protein can cause nonsyndromic deafness. Several transcript variants encoding different isoforms of each protein have been found for this gene, along with a transcript that is not thought to be protein-coding.
- Poids moléculaire
- 22 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-