CDRT4 anticorps (Middle Region)

N° du produit ABIN632369

Détail du produit anti-CDRT4 anticorps

Antigène: CDRT4 (CMT1A Duplicated Region Transcript 4 (CDRT4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDRT4 est non-conjugé

Application: Western Blotting (WB)

Specificité: CDRT4 antibody was raised against the middle region of CDRT4

Purification: Affinity purified

Immunogène: CDRT4 antibody was raised using the middle region of CDRT4 corresponding to a region with amino acids TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDRT4 Blocking Peptide, catalog no. 33R-9293, is also available for use as a blocking control in assays to test for specificity of this CDRT4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDRT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDRT4

Antigène: CDRT4 (CMT1A Duplicated Region Transcript 4 (CDRT4))

Autre désignation: CDRT4 (CDRT4 Produits)

Synonymes: anticorps 1700019I23Rik, anticorps CMT1A duplicated region transcript 4, anticorps CDRT4, anticorps Cdrt4

Sujet: The specific function of CDRT4 is not yet known.

Poids moléculaire: 17 kDa (MW of target protein)