RIMKLA anticorps (Middle Region)

N° du produit ABIN632370

Cet anticorps anti-RIMKLA Polyclonal Lapin (ABIN632370) détecte spécifiquement RIMKLA dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour RIMKLA anticorps (Middle Region) (ABIN632370)

Antigène: RIMKLA (Ribosomal Modification Protein RimK-Like Family Member A (RIMKLA))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RIMKLA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RIMKLA anticorps

Épitope: Middle Region

Specificité: FAM80 A antibody was raised against the middle region of FAM80

Purification: Affinity purified

Immunogène: FAM80 A antibody was raised using the middle region of FAM80 corresponding to a region with amino acids EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM80A Blocking Peptide, (ABIN937641), is also available for use as a blocking control in assays to test for specificity of this FAM80A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RIMKLA

Antigène: RIMKLA (Ribosomal Modification Protein RimK-Like Family Member A (RIMKLA))

Autre désignation: FAM80A

Sujet: The specific function of FAM80A is not yet known.

Poids moléculaire: 38 kDa (MW of target protein)