FBXO33 anticorps (Middle Region)

N° du produit ABIN632372

L’anticorps Lapin Polyclonal anti-FBXO33 a été validé pour WB. Il convient pour détecter FBXO33 dans des échantillons de Rat, Humain et Souris.

Aperçu rapide pour FBXO33 anticorps (Middle Region) (ABIN632372)

Antigène: FBXO33 (F-Box Protein 33 (FBXO33))

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO33 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FBXO33 anticorps

Épitope: Middle Region

Specificité: FBXO33 antibody was raised against the middle region of FBXO33

Purification: Affinity purified

Immunogène: FBXO33 antibody was raised using the middle region of FBXO33 corresponding to a region with amino acids VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO33 Blocking Peptide, (ABIN5613545), is also available for use as a blocking control in assays to test for specificity of this FBXO33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO33

Antigène: FBXO33 (F-Box Protein 33 (FBXO33))

Autre désignation: FBXO33

Sujet: FBXO33 is the substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO33 probably recognises and binds to phosphorylated target proteins. recognises YBX1.

Poids moléculaire: 62 kDa (MW of target protein)