FBXO33 anticorps (Middle Region)
-
- Antigène Voir toutes FBXO33 Anticorps
- FBXO33 (F-Box Protein 33 (FBXO33))
-
Épitope
- Middle Region
-
Reactivité
- Rat, Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXO33 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXO33 antibody was raised against the middle region of FBXO33
- Purification
- Affinity purified
- Immunogène
- FBXO33 antibody was raised using the middle region of FBXO33 corresponding to a region with amino acids VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL
- Top Product
- Discover our top product FBXO33 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXO33 Blocking Peptide, catalog no. 33R-9590, is also available for use as a blocking control in assays to test for specificity of this FBXO33 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO33 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXO33 (F-Box Protein 33 (FBXO33))
- Autre désignation
- FBXO33 (FBXO33 Produits)
- Synonymes
- anticorps FBXO33, anticorps BMND12, anticorps Fbx33, anticorps c14_5247, anticorps 5730501N20Rik, anticorps AI642135, anticorps F-box protein 33, anticorps F-box protein 33 S homeolog, anticorps FBXO33, anticorps fbxo33, anticorps fbxo33.S, anticorps Fbxo33
- Sujet
- FBXO33 is the substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO33 probably recognises and binds to phosphorylated target proteins. recognises YBX1.
- Poids moléculaire
- 62 kDa (MW of target protein)
-