PFKFB4 anticorps (N-Term)

N° du produit ABIN632373

Cet anticorps anti-PFKFB4 est un anticorps Lapin Polyclonal détectant PFKFB4 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour PFKFB4 anticorps (N-Term) (ABIN632373)

Antigène: PFKFB4 (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PFKFB4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PFKFB4 anticorps

Épitope: N-Term

Specificité: PFKFB4 antibody was raised against the N terminal of PFKFB4

Purification: Affinity purified

Immunogène: PFKFB4 antibody was raised using the N terminal of PFKFB4 corresponding to a region with amino acids MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PFKFB4 Blocking Peptide, (ABIN5615325), is also available for use as a blocking control in assays to test for specificity of this PFKFB4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKFB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PFKFB4

Antigène: PFKFB4 (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4))

Autre désignation: PFKFB4

Sujet: PFKFB4 synthesis and degradation of fructose 2,6-bisphosphate.

Poids moléculaire: 54 kDa (MW of target protein)