HAUS7 anticorps (Middle Region)

N° du produit ABIN632374

Cet anticorps Lapin Polyclonal détecte spécifiquement HAUS7 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour HAUS7 anticorps (Middle Region) (ABIN632374)

Antigène: HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAUS7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HAUS7 anticorps

Épitope: Middle Region

Specificité: UCHL5 IP antibody was raised against the middle region of UCHL5 P

Purification: Affinity purified

Immunogène: UCHL5 IP antibody was raised using the middle region of UCHL5 P corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UCHL5IP Blocking Peptide, (ABIN940511), is also available for use as a blocking control in assays to test for specificity of this UCHL5IP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAUS7

Antigène: HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))

Autre désignation: UCHL5IP

Sujet: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

Poids moléculaire: 47 kDa (MW of target protein)