HAUS7 anticorps (Middle Region)
-
- Antigène Voir toutes HAUS7 Anticorps
- HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HAUS7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UCHL5 IP antibody was raised against the middle region of UCHL5 P
- Purification
- Affinity purified
- Immunogène
- UCHL5 IP antibody was raised using the middle region of UCHL5 P corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC
- Top Product
- Discover our top product HAUS7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UCHL5IP Blocking Peptide, catalog no. 33R-5125, is also available for use as a blocking control in assays to test for specificity of this UCHL5IP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL0 P antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))
- Autre désignation
- UCHL5IP (HAUS7 Produits)
- Synonymes
- anticorps UCHL5IP, anticorps UIP1, anticorps 1110020L19Rik, anticorps Uchl5ip, anticorps Uip1, anticorps RGD1562991, anticorps HAUS augmin like complex subunit 7, anticorps HAUS augmin-like complex, subunit 7, anticorps HAUS7, anticorps Haus7
- Sujet
- This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom
- Poids moléculaire
- 47 kDa (MW of target protein)
-