Leiomodin 1 anticorps

N° du produit ABIN632381

Détail du produit anti-Leiomodin 1 anticorps

Antigène: Leiomodin 1 (LMOD1)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Leiomodin 1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Leiomodin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Leiomodin 1 Blocking Peptide, catalog no. 33R-8783, is also available for use as a blocking control in assays to test for specificity of this Leiomodin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Leiomodin 1

Antigène: Leiomodin 1 (LMOD1)

Autre désignation: Leiomodin 1 (LMOD1 Produits)

Synonymes: anticorps 1D, anticorps 64kD, anticorps D1, anticorps SM-LMOD, anticorps 9530015K06Rik, anticorps SM-Lmod, anticorps leiomodin 1, anticorps leiomodin 1 (smooth muscle), anticorps LMOD1, anticorps Lmod1

Sujet: The leiomodin 1 protein (LMOD1) has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.

Poids moléculaire: 67 kDa (MW of target protein)