Amphiphysin anticorps (N-Term)

N° du produit ABIN632382

Détail du produit anti-Amphiphysin anticorps

Antigène: Amphiphysin (AMPH)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Amphiphysin est non-conjugé

Application: Western Blotting (WB)

Specificité: Amphiphysin antibody was raised against the N terminal of AMPH

Purification: Affinity purified

Immunogène: Amphiphysin antibody was raised using the N terminal of AMPH corresponding to a region with amino acids ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Amphiphysin Blocking Peptide, catalog no. 33R-1095, is also available for use as a blocking control in assays to test for specificity of this Amphiphysin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Amphiphysin

Antigène: Amphiphysin (AMPH)

Autre désignation: Amphiphysin (AMPH Produits)

Synonymes: anticorps Amp, anticorps CG8604, anticorps DAMP, anticorps Damp, anticorps Dmel\\CG8604, anticorps amph, anticorps dAmph, anticorps damph, anticorps AMPH, anticorps Amph, anticorps GB16263, anticorps AMPH1, anticorps Amph1, anticorps wu:fq25h04, anticorps zgc:73193, anticorps amphiphysin, anticorps Amphiphysin, anticorps amphiphysin L homeolog, anticorps AMPH, anticorps Amph, anticorps amph, anticorps LOC409851, anticorps amph.L, anticorps LOC100343468

Sujet: AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.

Poids moléculaire: 76 kDa (MW of target protein)