COPG anticorps (N-Term)

N° du produit ABIN632383

Cet anticorps Lapin Polyclonal détecte spécifiquement COPG dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour COPG anticorps (N-Term) (ABIN632383)

Antigène: COPG (Coatomer Protein Complex, Subunit gamma (COPG))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COPG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-COPG anticorps

Épitope: N-Term

Specificité: COPG antibody was raised against the N terminal of COPG

Purification: Affinity purified

Immunogène: COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COPG Blocking Peptide, (ABIN5612962), is also available for use as a blocking control in assays to test for specificity of this COPG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COPG

Antigène: COPG (Coatomer Protein Complex, Subunit gamma (COPG))

Autre désignation: COPG

Sujet: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Poids moléculaire: 98 kDa (MW of target protein)