NECAP2 anticorps (N-Term)

N° du produit ABIN632387

Détail du produit anti-NECAP2 anticorps

Antigène: NECAP2 (NECAP Endocytosis Associated 2 (NECAP2))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NECAP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NECAP2 antibody was raised against the N terminal of NECAP2

Purification: Affinity purified

Immunogène: NECAP2 antibody was raised using the N terminal of NECAP2 corresponding to a region with amino acids WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NECAP2 Blocking Peptide, catalog no. 33R-9994, is also available for use as a blocking control in assays to test for specificity of this NECAP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NECAP2

Antigène: NECAP2 (NECAP Endocytosis Associated 2 (NECAP2))

Autre désignation: NECAP2 (NECAP2 Produits)

Synonymes: anticorps MGC83534, anticorps 1110005F07Rik, anticorps AA409105, anticorps C78898, anticorps NECAP endocytosis associated 2, anticorps NECAP endocytosis associated 2 L homeolog, anticorps NECAP2, anticorps necap2.L, anticorps necap2, anticorps Necap2

Sujet: This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.

Poids moléculaire: 28 kDa (MW of target protein)