gamma 1 Adaptin anticorps (C-Term)

N° du produit ABIN632398

Détail du produit anti-gamma 1 Adaptin anticorps

Antigène: gamma 1 Adaptin (AP1G1) (Adaptor-Related Protein Complex 1, gamma 1 Subunit (AP1G1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp gamma 1 Adaptin est non-conjugé

Application: Western Blotting (WB)

Specificité: AP1 G1 antibody was raised against the C terminal of AP1 1

Purification: Affinity purified

Immunogène: AP1 G1 antibody was raised using the C terminal of AP1 1 corresponding to a region with amino acids DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AP1G1 Blocking Peptide, catalog no. 33R-1979, is also available for use as a blocking control in assays to test for specificity of this AP1G1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur gamma 1 Adaptin

Antigène: gamma 1 Adaptin (AP1G1) (Adaptor-Related Protein Complex 1, gamma 1 Subunit (AP1G1))

Autre désignation: AP1G1 (AP1G1 Produits)

Synonymes: anticorps ADTG, anticorps CLAPG1, anticorps AA409002, anticorps AU041323, anticorps AW551707, anticorps Adtg, anticorps D8Ertd374e, anticorps adtg, anticorps wu:fc30a11, anticorps zgc:56079, anticorps AP1G1, anticorps adaptor related protein complex 1 gamma 1 subunit, anticorps AP-1 complex subunit gamma-1, anticorps AP-1 adaptor complex gamma subunit Apl4, anticorps hypothetical protein, anticorps adaptor protein complex AP-1, gamma 1 subunit, anticorps adaptor-related protein complex 1, gamma 1 subunit, anticorps adaptor related protein complex 1 gamma 1 subunit L homeolog, anticorps gamma-adaptin, anticorps AP1G1, anticorps NCU04121, anticorps PTRG_00081, anticorps SJAG_01809, anticorps UREG_02085, anticorps BDBG_07402, anticorps PAAG_11376, anticorps MCYG_00840, anticorps PITG_11143, anticorps VDBG_09354, anticorps Ap1g1, anticorps ap1g1, anticorps ap1g1.L, anticorps ANI_1_330014, anticorps AOR_1_802184, anticorps MGYG_01130, anticorps EDI_324200, anticorps TERG_00390, anticorps Tsp_09544

Sujet: Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.

Poids moléculaire: 91 kDa (MW of target protein)