AP3S1 anticorps (N-Term)

N° du produit ABIN632399

Détail du produit anti-AP3S1 anticorps

Antigène: AP3S1 (Adaptor-Related Protein Complex 3, sigma 1 Subunit (AP3S1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AP3S1 est non-conjugé

Application: Western Blotting (WB)

Specificité: AP3 S1 antibody was raised against the N terminal of AP3 1

Purification: Affinity purified

Immunogène: AP3 S1 antibody was raised using the N terminal of AP3 1 corresponding to a region with amino acids IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AP3S1 Blocking Peptide, catalog no. 33R-4012, is also available for use as a blocking control in assays to test for specificity of this AP3S1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AP3S1

Antigène: AP3S1 (Adaptor-Related Protein Complex 3, sigma 1 Subunit (AP3S1))

Autre désignation: AP3S1 (AP3S1 Produits)

Synonymes: anticorps CLAPS3, anticorps Sigma3A, anticorps [s]3A, anticorps adaptor related protein complex 3 sigma 1 subunit, anticorps adaptor-related protein complex 3, sigma 1 subunit, anticorps adaptor related protein complex 3 sigma 1 subunit S homeolog, anticorps AP3S1, anticorps Ap3s1, anticorps ap3s1.S

Sujet: AP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Poids moléculaire: 22 kDa (MW of target protein)