TTC23L anticorps (N-Term)

N° du produit ABIN632401

Détail du produit anti-TTC23L anticorps

Antigène: TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTC23L est non-conjugé

Application: Western Blotting (WB)

Specificité: FLJ25439 antibody was raised against the N terminal Of Flj25439

Purification: Affinity purified

Immunogène: FLJ25439 antibody was raised using the N terminal Of Flj25439 corresponding to a region with amino acids MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ25439 Blocking Peptide, catalog no. 33R-6319, is also available for use as a blocking control in assays to test for specificity of this FLJ25439 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ25439 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTC23L

Antigène: TTC23L (Tetratricopeptide Repeat Domain 23-Like (TTC23L))

Abstract: TTC23L Produits

Synonymes: anticorps RGD1564928, anticorps MC25-1, anticorps 4930401A09Rik, anticorps tetratricopeptide repeat domain 23 like, anticorps tetratricopeptide repeat domain 23-like, anticorps TTC23L, anticorps Ttc23l, anticorps ttc23l

Sujet: The function of FLJ25439 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 41 kDa (MW of target protein)