COPG2 anticorps (N-Term)

N° du produit ABIN632404

Cet anticorps Lapin Polyclonal détecte spécifiquement COPG2 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour COPG2 anticorps (N-Term) (ABIN632404)

Antigène: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COPG2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-COPG2 anticorps

Épitope: N-Term

Specificité: COPG2 antibody was raised against the N terminal of COPG2

Purification: Affinity purified

Immunogène: COPG2 antibody was raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COPG2 Blocking Peptide, (ABIN5612963), is also available for use as a blocking control in assays to test for specificity of this COPG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COPG2

Antigène: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Autre désignation: COPG2

Sujet: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Poids moléculaire: 97 kDa (MW of target protein)