PITPNB anticorps (Middle Region)

N° du produit ABIN632405

L’anticorps anti-PITPNB Polyclonal Lapin est utilisé pour la détection de PITPNB dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour PITPNB anticorps (Middle Region) (ABIN632405)

Antigène: PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PITPNB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PITPNB anticorps

Épitope: Middle Region

Specificité: PITPNB antibody was raised against the middle region of PITPNB

Purification: Affinity purified

Immunogène: PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PITPNB Blocking Peptide, (ABIN938276), is also available for use as a blocking control in assays to test for specificity of this PITPNB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PITPNB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PITPNB

Antigène: PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))

Autre désignation: PITPNB

Sujet: PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.

Poids moléculaire: 31 kDa (MW of target protein)