OSGEP anticorps (N-Term)

N° du produit ABIN632411

L’anticorps Lapin Polyclonal anti-OSGEP a été validé pour WB. Il convient pour détecter OSGEP dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour OSGEP anticorps (N-Term) (ABIN632411)

Antigène: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OSGEP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OSGEP anticorps

Épitope: N-Term

Specificité: OSGEP antibody was raised against the N terminal of OSGEP

Purification: Affinity purified

Immunogène: OSGEP antibody was raised using the N terminal of OSGEP corresponding to a region with amino acids PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OSGEP Blocking Peptide, (ABIN5615149), is also available for use as a blocking control in assays to test for specificity of this OSGEP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGEP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OSGEP

Antigène: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Autre désignation: OSGEP

Sujet: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Poids moléculaire: 36 kDa (MW of target protein)