OSGEP anticorps (N-Term)

N° du produit ABIN632411

Détail du produit anti-OSGEP anticorps

Antigène: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OSGEP est non-conjugé

Application: Western Blotting (WB)

Specificité: OSGEP antibody was raised against the N terminal of OSGEP

Purification: Affinity purified

Immunogène: OSGEP antibody was raised using the N terminal of OSGEP corresponding to a region with amino acids PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OSGEP Blocking Peptide, catalog no. 33R-7254, is also available for use as a blocking control in assays to test for specificity of this OSGEP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGEP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OSGEP

Antigène: OSGEP (O-Sialoglycoprotein Endopeptidase (OSGEP))

Autre désignation: OSGEP (OSGEP Produits)

Synonymes: anticorps MGC64557, anticorps wu:fj38e02, anticorps zgc:112527, anticorps si:ch211-214j24.11, anticorps Afu6g04510, anticorps Tb07.33N13.430, anticorps GCPL1, anticorps KAE1, anticorps OSGEP1, anticorps PRSMG1, anticorps 1500019L24Rik, anticorps GCPL-1, anticorps O-sialoglycoprotein endopeptidase L homeolog, anticorps O-sialoglycoprotein endopeptidase, anticorps o-sialoglycoprotein endopeptidase, anticorps osgep.L, anticorps OSGEP, anticorps osgep, anticorps CNA03390, anticorps AFUA_6G04510, anticorps Tc00.1047053508913.39, anticorps Tc00.1047053506515.20, anticorps Tb927.7.6470, anticorps PVX_111195, anticorps AaeL_AAEL001942, anticorps GL50803_17420, anticorps EDI_342200, anticorps CC1G_03622, anticorps THAPSDRAFT_2332, anticorps TTHERM_00442549, anticorps Osgep, anticorps LOC100273984

Sujet: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Poids moléculaire: 36 kDa (MW of target protein)