TPPP3 anticorps (N-Term)

N° du produit ABIN632414

L’anticorps Lapin Polyclonal anti-TPPP3 a été validé pour WB. Il convient pour détecter TPPP3 dans des échantillons de Humain.

Aperçu rapide pour TPPP3 anticorps (N-Term) (ABIN632414)

Antigène: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPPP3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TPPP3 anticorps

Épitope: N-Term

Specificité: TPPP3 antibody was raised against the N terminal of TPPP3

Purification: Affinity purified

Immunogène: TPPP3 antibody was raised using the N terminal of TPPP3 corresponding to a region with amino acids MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TPPP3 Blocking Peptide, (ABIN5616742), is also available for use as a blocking control in assays to test for specificity of this TPPP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPPP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPPP3

Antigène: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Autre désignation: TPPP3

Sujet: TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.

Poids moléculaire: 19 kDa (MW of target protein)