TPPP3 anticorps (Middle Region)

N° du produit ABIN632416

Détail du produit anti-TPPP3 anticorps

Antigène: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPPP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TPPP3 antibody was raised against the middle region of TPPP3

Purification: Affinity purified

Immunogène: TPPP3 antibody was raised using the middle region of TPPP3 corresponding to a region with amino acids PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TPPP3 Blocking Peptide, catalog no. 33R-6969, is also available for use as a blocking control in assays to test for specificity of this TPPP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPPP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPPP3

Antigène: TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))

Autre désignation: TPPP3 (TPPP3 Produits)

Synonymes: anticorps p20, anticorps p25gamma, anticorps 2700055K07Rik, anticorps CGI-38, anticorps Ceacam9, anticorps mmCGM8, anticorps RGD1305061, anticorps tubulin polymerization promoting protein family member 3, anticorps tubulin polymerization-promoting protein family member 3, anticorps tubulin polymerization-promoting protein family member 3 L homeolog, anticorps TPPP3, anticorps Tppp3, anticorps tppp3.L

Sujet: TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.

Poids moléculaire: 19 kDa (MW of target protein)