PDP2 anticorps (Middle Region)

N° du produit ABIN632420

L’anticorps anti-PDP2 Polyclonal Lapin est utilisé pour la détection de PDP2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour PDP2 anticorps (Middle Region) (ABIN632420)

Antigène: PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDP2 anticorps

Épitope: Middle Region

Specificité: PDP2 antibody was raised against the middle region of PDP2

Purification: Affinity purified

Immunogène: PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDP2 Blocking Peptide, (ABIN5615293), is also available for use as a blocking control in assays to test for specificity of this PDP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDP2

Antigène: PDP2 (Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 (PDP2))

Autre désignation: PDP2

Sujet: PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

Poids moléculaire: 60 kDa (MW of target protein)