KLHL7 anticorps

N° du produit ABIN632426

L’anticorps Lapin Polyclonal anti-KLHL7 a été validé pour WB. Il convient pour détecter KLHL7 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour KLHL7 anticorps (ABIN632426)

Antigène: KLHL7 (Kelch-Like 7 (KLHL7))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHL7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KLHL7 anticorps

Purification: Affinity purified

Immunogène: KLHL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHL7 Blocking Peptide, (ABIN936983), is also available for use as a blocking control in assays to test for specificity of this KLHL7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHL7

Antigène: KLHL7 (Kelch-Like 7 (KLHL7))

Autre désignation: KLHL7

Sujet: Defects in KLHL7 are the cause of retinitis pigmentosa type 42 (RP42). The specific function of this protein remains unknown.

Poids moléculaire: 62 kDa (MW of target protein)